Lineage for d1ngpl2 (1ngp L:110-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 656556Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 656637Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
  8. 656649Domain d1ngpl2: 1ngp L:110-211 [21122]
    Other proteins in same PDB: d1ngph1, d1ngph2, d1ngpl1
    part of Fab N1G9
    complexed with npa, so4

Details for d1ngpl2

PDB Entry: 1ngp (more details), 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3- nitrophenyl) acetate
PDB Compounds: (L:) n1g9 (igg1-lambda)

SCOP Domain Sequences for d1ngpl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngpl2 b.1.1.2 (L:110-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarawerhssyscqvtheghtvekslsr

SCOP Domain Coordinates for d1ngpl2:

Click to download the PDB-style file with coordinates for d1ngpl2.
(The format of our PDB-style files is described here.)

Timeline for d1ngpl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngpl1