![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (16 species) not a true protein |
![]() | Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries) |
![]() | Domain d3hq8b1: 3hq8 B:22-188 [211218] automated match to d1nmla1 complexed with ca, hem, imd |
PDB Entry: 3hq8 (more details), 2.4 Å
SCOPe Domain Sequences for d3hq8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hq8b1 a.3.1.0 (B:22-188) automated matches {Geobacter sulfurreducens [TaxId: 35554]} adelqqraqglfkpvpakaptlkgnpaspvkvelgkmlyfdprlsashliscntchnvgl gggdlqatstghgwqkgprnaptvlnsvfntaqfwdgrakdlaeqakgpvqapkemnntp dqvvktlnsipdyvalfkkafpgekdpvtfdnmakaievfeatlitp
Timeline for d3hq8b1: