Lineage for d3hq8a1 (3hq8 A:22-188)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1477453Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1477454Protein automated matches [190453] (16 species)
    not a true protein
  7. 1477475Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)
  8. 1477488Domain d3hq8a1: 3hq8 A:22-188 [211216]
    automated match to d1nmla1
    complexed with ca, hem, imd

Details for d3hq8a1

PDB Entry: 3hq8 (more details), 2.4 Å

PDB Description: ccpa from g. sulfurreducens s134p/v135k variant
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3hq8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hq8a1 a.3.1.0 (A:22-188) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
adelqqraqglfkpvpakaptlkgnpaspvkvelgkmlyfdprlsashliscntchnvgl
gggdlqatstghgwqkgprnaptvlnsvfntaqfwdgrakdlaeqakgpvqapkemnntp
dqvvktlnsipdyvalfkkafpgekdpvtfdnmakaievfeatlitp

SCOPe Domain Coordinates for d3hq8a1:

Click to download the PDB-style file with coordinates for d3hq8a1.
(The format of our PDB-style files is described here.)

Timeline for d3hq8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hq8a2