Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (26 species) not a true protein |
Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries) |
Domain d3hq6a2: 3hq6 A:189-345 [211211] automated match to d1nmla2 complexed with ca, hem |
PDB Entry: 3hq6 (more details), 2 Å
SCOPe Domain Sequences for d3hq6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hq6a2 a.3.1.0 (A:189-345) automated matches {Geobacter sulfurreducens [TaxId: 35554]} dspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekpaenilp lgdkgrfavtntakdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsaqfgiklsd deseaiaaflgsltgkqpkvvypimpastdatprprl
Timeline for d3hq6a2: