Lineage for d3hq6a2 (3hq6 A:189-345)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691652Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)
  8. 2691659Domain d3hq6a2: 3hq6 A:189-345 [211211]
    automated match to d1nmla2
    complexed with ca, hem

Details for d3hq6a2

PDB Entry: 3hq6 (more details), 2 Å

PDB Description: Cytochrome c peroxidase from G. sulfurreducens, wild type
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3hq6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hq6a2 a.3.1.0 (A:189-345) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
dspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekpaenilp
lgdkgrfavtntakdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsaqfgiklsd
deseaiaaflgsltgkqpkvvypimpastdatprprl

SCOPe Domain Coordinates for d3hq6a2:

Click to download the PDB-style file with coordinates for d3hq6a2.
(The format of our PDB-style files is described here.)

Timeline for d3hq6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hq6a1