Lineage for d3hpyb2 (3hpy B:147-289)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1901256Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 1901257Protein automated matches [190239] (18 species)
    not a true protein
  7. 1901326Species Pseudomonas sp. [TaxId:237609] [225772] (3 PDB entries)
  8. 1901338Domain d3hpyb2: 3hpy B:147-289 [211197]
    automated match to d1mpya2
    complexed with fe, mct

Details for d3hpyb2

PDB Entry: 3hpy (more details), 1.94 Å

PDB Description: crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in the complex with 4-methylcatechol
PDB Compounds: (B:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d3hpyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hpyb2 d.32.1.0 (B:147-289) automated matches {Pseudomonas sp. [TaxId: 237609]}
iapiqldhcllygpniaevqkiftevlgfylvervlspdgdsdmgiwlscshkvhdiafv
eypekgklhhcsfllesweqvlragdimsmnevnvdigptrhgvtrgctiyawdpsgnrf
etfmggyhpypdyeplswtydnf

SCOPe Domain Coordinates for d3hpyb2:

Click to download the PDB-style file with coordinates for d3hpyb2.
(The format of our PDB-style files is described here.)

Timeline for d3hpyb2: