Lineage for d2rcsh2 (2rcs H:115-216)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103998Species Fab 48G7 (mouse/human), kappa L chain [49027] (4 PDB entries)
  8. 104003Domain d2rcsh2: 2rcs H:115-216 [21119]
    Other proteins in same PDB: d2rcsh1, d2rcsl1

Details for d2rcsh2

PDB Entry: 2rcs (more details), 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody

SCOP Domain Sequences for d2rcsh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcsh2 b.1.1.2 (H:115-216) Immunoglobulin (constant domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain}
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d2rcsh2:

Click to download the PDB-style file with coordinates for d2rcsh2.
(The format of our PDB-style files is described here.)

Timeline for d2rcsh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rcsh1