Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab 48G7 (mouse/human), kappa L chain [49027] (4 PDB entries) |
Domain d2rcsh2: 2rcs H:115-216 [21119] Other proteins in same PDB: d2rcsh1, d2rcsl1 |
PDB Entry: 2rcs (more details), 2.1 Å
SCOP Domain Sequences for d2rcsh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcsh2 b.1.1.2 (H:115-216) Immunoglobulin (constant domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain} stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d2rcsh2: