SCOPe 2.04: Domain d3horb2: 3hor B:172-269

Lineage for d3horb2 (3hor B:172-269)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (24 PDB entries)

8. Domain d3horb2: 3hor B:172-269 [211181]
   automated match to d1sh5a2
   complexed with po4

Details for d3horb2

PDB Entry: 3hor, 2.7 Å

PDB Description: Structure of the actin-binding domain of human filamin A (reduced)

PDB Compounds: (B:) Filamin-A

SCOPe Domain Sequences for d3horb2:

Sequence; same for both SEQRES and ATOM records:

>d3horb2 a.40.1.0 (B:172-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llgwiqnklpqlpitnfsrdwqsgralgalvdscapglcpdwdswdaskpvtnareamqq
addwlgipqvitpeeivdpnvdehsvmtylsqfpkakl

Timeline for d3horb2:

• d3horb2 first appeared in SCOPe 2.03
  
• d3horb2 appears in SCOPe 2.05
  
• d3horb2 appears in the current release, SCOPe 2.08