Class a: All alpha proteins [46456] (290 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
Domain d3hora1: 3hor A:43-151 [211178] automated match to d1sh5a1 complexed with po4 |
PDB Entry: 3hor (more details), 2.7 Å
SCOPe Domain Sequences for d3hora1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hora1 a.40.1.0 (A:43-151) automated matches {Human (Homo sapiens) [TaxId: 9606]} kiqqntftrwcnehlkcvskrianlqtdlsdglrliallevlsqkkmhrkhnqrptfrqm qlenvsvalefldresiklvsidskaivdgnlklilgliwtlilhysis
Timeline for d3hora1: