Class a: All alpha proteins [46456] (285 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (24 PDB entries) |
Domain d3hopb1: 3hop B:39-161 [211176] automated match to d1sh5a1 complexed with po4 |
PDB Entry: 3hop (more details), 2.3 Å
SCOPe Domain Sequences for d3hopb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hopb1 a.40.1.0 (B:39-161) automated matches {Human (Homo sapiens) [TaxId: 9606]} apwkkiqqntftrwcnehlkcvskrianlqtdlsdglrliallevlsqkkmhrkhnqrpt frqmqlenvsvalefldresiklvsidskaivdgnlklilgliwtlilhysismpmwdee ede
Timeline for d3hopb1: