SCOPe 2.06: Domain d3hocb2: 3hoc B:166-269

Lineage for d3hocb2 (3hoc B:166-269)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (30 PDB entries)

8. Domain d3hocb2: 3hoc B:166-269 [211170]
   automated match to d1sh5a2
   complexed with po4; mutant

Details for d3hocb2

PDB Entry: 3hoc, 2.3 Å

PDB Description: structure of the actin-binding domain of human filamin a mutant e254k

PDB Compounds: (B:) Filamin-A

SCOPe Domain Sequences for d3hocb2:

Sequence; same for both SEQRES and ATOM records:

>d3hocb2 a.40.1.0 (B:166-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtpkqrllgwiqnklpqlpitnfsrdwqsgralgalvdscapglcpdwdswdaskpvtna
reamqqaddwlgipqvitpeeivdpnvdkhsvmtylsqfpkakl

Timeline for d3hocb2:

• d3hocb2 first appeared in SCOPe 2.03
  
• d3hocb2 appears in SCOPe 2.05
  
• d3hocb2 appears in SCOPe 2.07
  
• d3hocb2 appears in the current release, SCOPe 2.08