Lineage for d3hoca2 (3hoc A:166-265)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1734996Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1734997Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1735075Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 1735076Protein automated matches [226856] (2 species)
    not a true protein
  7. 1735077Species Human (Homo sapiens) [TaxId:9606] [224978] (26 PDB entries)
  8. 1735099Domain d3hoca2: 3hoc A:166-265 [211168]
    automated match to d1sh5a2
    complexed with po4; mutant

Details for d3hoca2

PDB Entry: 3hoc (more details), 2.3 Å

PDB Description: structure of the actin-binding domain of human filamin a mutant e254k
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d3hoca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hoca2 a.40.1.0 (A:166-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtpkqrllgwiqnklpqlpitnfsrdwqsgralgalvdscapglcpdwdswdaskpvtna
reamqqaddwlgipqvitpeeivdpnvdkhsvmtylsqfp

SCOPe Domain Coordinates for d3hoca2:

Click to download the PDB-style file with coordinates for d3hoca2.
(The format of our PDB-style files is described here.)

Timeline for d3hoca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hoca1