SCOPe 2.08: Domain d3ho7a1: 3ho7 A:90-308

Lineage for d3ho7a1 (3ho7 A:90-308)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Porphyromonas gingivalis [TaxId:837] [225908] (2 PDB entries)

8. Domain d3ho7a1: 3ho7 A:90-308 [211163]
   Other proteins in same PDB: d3ho7a2, d3ho7b2
   automated match to d1i6aa_

Details for d3ho7a1

PDB Entry: 3ho7, 1.58 Å

PDB Description: Crystal structure of OxyR from Porphyromonas gingivalis

PDB Compounds: (A:) OxyR

SCOPe Domain Sequences for d3ho7a1:

Sequence; same for both SEQRES and ATOM records:

>d3ho7a1 c.94.1.0 (A:90-308) automated matches {Porphyromonas gingivalis [TaxId: 837]}
tgrlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiask
aetegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghcfrdqlvrfcq
mkglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrev
rlavrqdysrrklreqligllrsavpsdmhklqtgqhla

Timeline for d3ho7a1:

• d3ho7a1 first appeared in SCOPe 2.03, called d3ho7a_
  
• d3ho7a1 appears in SCOPe 2.07