Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Porphyromonas gingivalis [TaxId:837] [225908] (2 PDB entries) |
Domain d3ho7a1: 3ho7 A:90-308 [211163] Other proteins in same PDB: d3ho7a2, d3ho7b2 automated match to d1i6aa_ |
PDB Entry: 3ho7 (more details), 1.58 Å
SCOPe Domain Sequences for d3ho7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ho7a1 c.94.1.0 (A:90-308) automated matches {Porphyromonas gingivalis [TaxId: 837]} tgrlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiask aetegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghcfrdqlvrfcq mkglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrev rlavrqdysrrklreqligllrsavpsdmhklqtgqhla
Timeline for d3ho7a1: