SCOPe 2.08: Domain d3hnab_: 3hna B:

Lineage for d3hnab_ (3hna B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core
   Pfam PF00856

5. Family b.85.7.0: automated matches [227191] (1 protein)
   not a true family

6. Protein automated matches [226914] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225158] (28 PDB entries)

8. Domain d3hnab_: 3hna B: [211152]
   Other proteins in same PDB: d3hnaa2
   automated match to d1pega_
   complexed with sah, zn

Details for d3hnab_

PDB Entry: 3hna, 1.5 Å

PDB Description: Crystal structure of catalytic domain of human euchromatic histone methyltransferase 1 in complex with SAH and mono-Methylated H3K9 Peptide

PDB Compounds: (B:) Histone-lysine N-methyltransferase, H3 lysine-9 specific 5

SCOPe Domain Sequences for d3hnab_:

Sequence; same for both SEQRES and ATOM records:

>d3hnab_ b.85.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvcid
dcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglra
rlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkdgevyc
idarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerf
wdikgklfscrcgspkcrhs

Timeline for d3hnab_:

• d3hnab_ first appeared in SCOPe 2.03
  
• d3hnab_ appears in SCOPe 2.07