Lineage for d1gafh2 (1gaf H:115-217)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221292Species Fab 48G7 (mouse/human), kappa L chain [49027] (4 PDB entries)
  8. 221293Domain d1gafh2: 1gaf H:115-217 [21115]
    Other proteins in same PDB: d1gafh1, d1gafl1
    complexed with npe

Details for d1gafh2

PDB Entry: 1gaf (more details), 1.95 Å

PDB Description: 48g7 hybridoma line fab complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid

SCOP Domain Sequences for d1gafh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gafh2 b.1.1.2 (H:115-217) Immunoglobulin (constant domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1gafh2:

Click to download the PDB-style file with coordinates for d1gafh2.
(The format of our PDB-style files is described here.)

Timeline for d1gafh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gafh1