Lineage for d3hn6d_ (3hn6 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885422Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1885423Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1885702Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 1885703Protein automated matches [191112] (11 species)
    not a true protein
  7. 1885763Species Borrelia burgdorferi [TaxId:224326] [225689] (1 PDB entry)
  8. 1885767Domain d3hn6d_: 3hn6 D: [211149]
    automated match to d1fsfa_
    complexed with pop

Details for d3hn6d_

PDB Entry: 3hn6 (more details), 2.2 Å

PDB Description: crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi
PDB Compounds: (D:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d3hn6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hn6d_ c.124.1.0 (D:) automated matches {Borrelia burgdorferi [TaxId: 224326]}
pgsmrliirptyediskwaanhvaqkinefsptkenpfilglptgsspigmyknlielnk
nkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidikkeninilngnasnlkke
ceeyekkiksfggimlfvggigpdghiafnepgssltsrtriktltqdtiiansrffegd
vnkvpknaltvgigtimdsqevliivnghnkaralkhaiekgvnhmwtisalqlhknaii
vsdknatyelkvgtveyfndierknfnndl

SCOPe Domain Coordinates for d3hn6d_:

Click to download the PDB-style file with coordinates for d3hn6d_.
(The format of our PDB-style files is described here.)

Timeline for d3hn6d_: