Lineage for d3hn6a_ (3hn6 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1395793Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1395794Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1396069Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 1396070Protein automated matches [191112] (8 species)
    not a true protein
  7. 1396126Species Borrelia burgdorferi [TaxId:224326] [225689] (1 PDB entry)
  8. 1396127Domain d3hn6a_: 3hn6 A: [211146]
    automated match to d1fsfa_
    complexed with pop

Details for d3hn6a_

PDB Entry: 3hn6 (more details), 2.2 Å

PDB Description: crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi
PDB Compounds: (A:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d3hn6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hn6a_ c.124.1.0 (A:) automated matches {Borrelia burgdorferi [TaxId: 224326]}
pgsmrliirptyediskwaanhvaqkinefsptkenpfilglptgsspigmyknlielnk
nkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidikkeninilngnasnlkke
ceeyekkiksfggimlfvggigpdghiafnepgssltsrtriktltqdtiiansrffegd
vnkvpknaltvgigtimdsqevliivnghnkaralkhaiekgvnhmwtisalqlhknaii
vsdknatyelkvgtveyfndierknfnndlk

SCOPe Domain Coordinates for d3hn6a_:

Click to download the PDB-style file with coordinates for d3hn6a_.
(The format of our PDB-style files is described here.)

Timeline for d3hn6a_: