Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Glucuronidase [49806] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49807] (2 PDB entries) |
Domain d3hn3b1: 3hn3 B:22-225 [211137] Other proteins in same PDB: d3hn3a2, d3hn3a3, d3hn3b2, d3hn3b3, d3hn3d2, d3hn3d3, d3hn3e2, d3hn3e3 automated match to d1bhga2 complexed with bma, mpd, mrd, nag |
PDB Entry: 3hn3 (more details), 1.7 Å
SCOPe Domain Sequences for d3hn3b1:
Sequence, based on SEQRES records: (download)
>d3hn3b1 b.18.1.5 (B:22-225) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]} glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle heggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfv qntyfdffnyaglqrsvllyttpt
>d3hn3b1 b.18.1.5 (B:22-225) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]} glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle heggylpfeadisnlvqvgsrlritiainntltpttlppgtiqyltdtskypkgyfvqnt yfdffnyaglqrsvllyttpt
Timeline for d3hn3b1: