Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Glucuronidase [49307] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49308] (2 PDB entries) |
Domain d3hn3a2: 3hn3 A:226-328 [211135] Other proteins in same PDB: d3hn3a1, d3hn3a3, d3hn3b1, d3hn3b3, d3hn3d1, d3hn3d3, d3hn3e1, d3hn3e3 automated match to d1bhga1 complexed with bma, mpd, mrd, nag, ndg |
PDB Entry: 3hn3 (more details), 1.7 Å
SCOPe Domain Sequences for d3hn3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hn3a2 b.1.4.1 (A:226-328) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]} tyidditvttsveqdsglvnyqisvkgsnlfklevrlldaenkvvangtgtqgqlkvpgv slwwpylmherpaylyslevqltaqtslgpvsdfytlpvgirt
Timeline for d3hn3a2: