Lineage for d1plgh2 (1plg H:118-215)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104573Species Polysialic acid-binding Fab (mouse), kappa L chain [49026] (1 PDB entry)
  8. 104574Domain d1plgh2: 1plg H:118-215 [21113]
    Other proteins in same PDB: d1plgh1, d1plgl1

Details for d1plgh2

PDB Entry: 1plg (more details), 2.8 Å

PDB Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid

SCOP Domain Sequences for d1plgh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plgh2 b.1.1.2 (H:118-215) Immunoglobulin (constant domains of L and H chains) {Polysialic acid-binding Fab (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkie

SCOP Domain Coordinates for d1plgh2:

Click to download the PDB-style file with coordinates for d1plgh2.
(The format of our PDB-style files is described here.)

Timeline for d1plgh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1plgh1