Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class pi GST [81358] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries) |
Domain d3hkrb1: 3hkr B:1-78 [211113] Other proteins in same PDB: d3hkra2, d3hkrb2 automated match to d1gssa2 complexed with ca, co3, mes; mutant |
PDB Entry: 3hkr (more details), 1.8 Å
SCOPe Domain Sequences for d3hkrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hkrb1 c.47.1.5 (B:1-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl tlyqsntilrhlgrtlgl
Timeline for d3hkrb1: