Lineage for d3hkra1 (3hkr A:2-78)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876959Protein Class pi GST [81358] (4 species)
  7. 2876960Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)
  8. 2876973Domain d3hkra1: 3hkr A:2-78 [211111]
    Other proteins in same PDB: d3hkra2, d3hkrb2
    automated match to d1gssa2
    complexed with ca, co3, mes; mutant

Details for d3hkra1

PDB Entry: 3hkr (more details), 1.8 Å

PDB Description: crystal structure of glutathione transferase pi y108v mutant
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3hkra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hkra1 c.47.1.5 (A:2-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtlgl

SCOPe Domain Coordinates for d3hkra1:

Click to download the PDB-style file with coordinates for d3hkra1.
(The format of our PDB-style files is described here.)

Timeline for d3hkra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hkra2