Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class pi GST [81347] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries) |
Domain d3hjob2: 3hjo B:79-209 [211105] Other proteins in same PDB: d3hjoa1, d3hjob1 automated match to d1gssa1 complexed with ca, co3, eaa, gsh; mutant |
PDB Entry: 3hjo (more details), 1.95 Å
SCOPe Domain Sequences for d3hjob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hjob2 a.45.1.1 (B:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} ygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvkalpgqlkpfetllsqnqg gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey vnlpingngkq
Timeline for d3hjob2: