SCOPe 2.08: Domain d3hjoa1: 3hjo A:1-78

Lineage for d3hjoa1 (3hjo A:1-78)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)

8. Domain d3hjoa1: 3hjo A:1-78 [211102]
   Other proteins in same PDB: d3hjoa2, d3hjob2
   automated match to d1gssa2
   complexed with ca, co3, eaa, gsh; mutant

Details for d3hjoa1

PDB Entry: 3hjo, 1.95 Å

PDB Description: crystal structure of glutathione transferase pi y108v mutant in complex with the glutathione conjugate of ethacrynic acid

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3hjoa1:

Sequence; same for both SEQRES and ATOM records:

>d3hjoa1 c.47.1.5 (A:1-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlgl

Timeline for d3hjoa1:

• d3hjoa1 first appeared in SCOPe 2.03
  
• d3hjoa1 appears in SCOPe 2.07