Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class pi GST [81347] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries) |
Domain d3hjmd2: 3hjm D:79-209 [211101] Other proteins in same PDB: d3hjma1, d3hjmb1, d3hjmc1, d3hjmd1 automated match to d1gssa1 complexed with ca, cl, co3, mes, po4; mutant |
PDB Entry: 3hjm (more details), 2.1 Å
SCOPe Domain Sequences for d3hjmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hjmd2 a.45.1.1 (D:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} ygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvkalpgqlkpfetllsqnqg gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey vnlpingngkq
Timeline for d3hjmd2: