SCOPe 2.08: Domain d3hjmd2: 3hjm D:79-209

Lineage for d3hjmd2 (3hjm D:79-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries)

8. Domain d3hjmd2: 3hjm D:79-209 [211101]
   Other proteins in same PDB: d3hjma1, d3hjmb1, d3hjmc1, d3hjmd1
   automated match to d1gssa1
   complexed with ca, cl, co3, mes, po4; mutant

Details for d3hjmd2

PDB Entry: 3hjm, 2.1 Å

PDB Description: crystal structure of human glutathione transferase pi y108v mutant

PDB Compounds: (D:) Glutathione S-transferase P

SCOPe Domain Sequences for d3hjmd2:

Sequence; same for both SEQRES and ATOM records:

>d3hjmd2 a.45.1.1 (D:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

Timeline for d3hjmd2:

• d3hjmd2 first appeared in SCOPe 2.03
  
• d3hjmd2 appears in SCOPe 2.07