Lineage for d1aifl2 (1aif L:110-215)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103991Species Fab 409.5.3 (mouse), kappa L chain [49025] (2 PDB entries)
  8. 103997Domain d1aifl2: 1aif L:110-215 [21110]
    Other proteins in same PDB: d1aifa1, d1aifb1, d1aifh1, d1aifl1

Details for d1aifl2

PDB Entry: 1aif (more details), 2.9 Å

PDB Description: anti-idiotypic fab 409.5.3 (igg2a) fab from mouse

SCOP Domain Sequences for d1aifl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aifl2 b.1.1.2 (L:110-215) Immunoglobulin (constant domains of L and H chains) {Fab 409.5.3 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1aifl2:

Click to download the PDB-style file with coordinates for d1aifl2.
(The format of our PDB-style files is described here.)

Timeline for d1aifl2: