SCOP 1.63: Domain d1aifb2: 1aif B:122-218

Lineage for d1aifb2 (1aif B:122-218)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 409.5.3 (mouse), kappa L chain [49025] (2 PDB entries)

8. Domain d1aifb2: 1aif B:122-218 [21109]
   Other proteins in same PDB: d1aifa1, d1aifb1, d1aifh1, d1aifl1

Details for d1aifb2

PDB Entry: 1aif, 2.9 Å

PDB Description: anti-idiotypic fab 409.5.3 (igg2a) fab from mouse

SCOP Domain Sequences for d1aifb2:

Sequence; same for both SEQRES and ATOM records:

>d1aifb2 b.1.1.2 (B:122-218) Immunoglobulin (constant domains of L and H chains) {Fab 409.5.3 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpstwrpsetvtcnvahpasstkvdkki

Timeline for d1aifb2:

• d1aifb2 first appeared (with stable ids) in SCOP 1.55
  
• d1aifb2 appears in SCOP 1.61
  
• d1aifb2 appears in SCOP 1.65
  
• d1aifb2 appears in the current release, SCOPe 2.08