Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab 409.5.3 (mouse), kappa L chain [49025] (2 PDB entries) |
Domain d1aifb2: 1aif B:122-218 [21109] Other proteins in same PDB: d1aifa1, d1aifb1, d1aifh1, d1aifl1 |
PDB Entry: 1aif (more details), 2.9 Å
SCOP Domain Sequences for d1aifb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aifb2 b.1.1.2 (B:122-218) Immunoglobulin (constant domains of L and H chains) {Fab 409.5.3 (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpstwrpsetvtcnvahpasstkvdkki
Timeline for d1aifb2: