![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
![]() | Domain d1iaih2: 1iai H:122-219 [21105] Other proteins in same PDB: d1iaih1, d1iaii1, d1iail1, d1iail2, d1iaim1, d1iaim2 part of Fab 730.1.4 |
PDB Entry: 1iai (more details), 2.9 Å
SCOP Domain Sequences for d1iaih2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaih2 b.1.1.2 (H:122-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtssttpsqsitcnvahpasstkvdkkid
Timeline for d1iaih2: