Lineage for d3hhqb_ (3hhq B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083304Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2083499Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2083500Protein automated matches [191182] (16 species)
    not a true protein
  7. 2083591Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189530] (3 PDB entries)
  8. 2083599Domain d3hhqb_: 3hhq B: [211041]
    automated match to d1sixa_
    complexed with cl, edo, gol, na, peg, so4

Details for d3hhqb_

PDB Entry: 3hhq (more details), 2 Å

PDB Description: Crystal structure of apo dUT1p from Saccharomyces cerevisiae
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3hhqb_:

Sequence, based on SEQRES records: (download)

>d3hhqb_ b.85.4.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygri
aprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaq
ivvvdslee

Sequence, based on observed residues (ATOM records): (download)

>d3hhqb_ b.85.4.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dkvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygria
prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
vvvdslee

SCOPe Domain Coordinates for d3hhqb_:

Click to download the PDB-style file with coordinates for d3hhqb_.
(The format of our PDB-style files is described here.)

Timeline for d3hhqb_: