Lineage for d1iail2 (1iai L:109-214)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104040Species Fab 730.1.4 (mouse), kappa L chain [49024] (1 PDB entry)
  8. 104042Domain d1iail2: 1iai L:109-214 [21104]
    Other proteins in same PDB: d1iaih1, d1iaii1, d1iail1, d1iaim1

Details for d1iail2

PDB Entry: 1iai (more details), 2.9 Å

PDB Description: idiotype-anti-idiotype fab complex

SCOP Domain Sequences for d1iail2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iail2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab 730.1.4 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1iail2:

Click to download the PDB-style file with coordinates for d1iail2.
(The format of our PDB-style files is described here.)

Timeline for d1iail2: