Lineage for d3hhpc2 (3hhp C:146-312)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1441214Protein automated matches [226882] (7 species)
    not a true protein
  7. 1441218Species Escherichia coli [TaxId:83333] [225274] (2 PDB entries)
  8. 1441221Domain d3hhpc2: 3hhp C:146-312 [211037]
    Other proteins in same PDB: d3hhpa1, d3hhpb1, d3hhpc1, d3hhpd1
    automated match to d2cmda2

Details for d3hhpc2

PDB Entry: 3hhp (more details), 1.45 Å

PDB Description: Malate dehydrogenase open conformation
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d3hhpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhpc2 d.162.1.1 (C:146-312) automated matches {Escherichia coli [TaxId: 83333]}
vttldiirsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgeefvnk

SCOPe Domain Coordinates for d3hhpc2:

Click to download the PDB-style file with coordinates for d3hhpc2.
(The format of our PDB-style files is described here.)

Timeline for d3hhpc2: