Lineage for d3hhpc1 (3hhp C:1-145)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350446Species Escherichia coli [TaxId:83333] [225273] (5 PDB entries)
  8. 1350453Domain d3hhpc1: 3hhp C:1-145 [211036]
    Other proteins in same PDB: d3hhpa2, d3hhpb2, d3hhpc2, d3hhpd2
    automated match to d2cmda1

Details for d3hhpc1

PDB Entry: 3hhp (more details), 1.45 Å

PDB Description: Malate dehydrogenase open conformation
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d3hhpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhpc1 c.2.1.0 (C:1-145) automated matches {Escherichia coli [TaxId: 83333]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

SCOPe Domain Coordinates for d3hhpc1:

Click to download the PDB-style file with coordinates for d3hhpc1.
(The format of our PDB-style files is described here.)

Timeline for d3hhpc1: