SCOPe 2.06: Domain d3hhpa1: 3hhp A:1-145

Lineage for d3hhpa1 (3hhp A:1-145)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188668] (7 PDB entries)

8. Domain d3hhpa1: 3hhp A:1-145 [211032]
   Other proteins in same PDB: d3hhpa2, d3hhpb2, d3hhpc2, d3hhpd2
   automated match to d2cmda1

Details for d3hhpa1

PDB Entry: 3hhp, 1.45 Å

PDB Description: Malate dehydrogenase open conformation

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d3hhpa1:

Sequence; same for both SEQRES and ATOM records:

>d3hhpa1 c.2.1.0 (A:1-145) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

Timeline for d3hhpa1:

• d3hhpa1 first appeared in SCOPe 2.03
  
• d3hhpa1 appears in SCOPe 2.05
  
• d3hhpa1 appears in SCOPe 2.07
  
• d3hhpa1 appears in the current release, SCOPe 2.08