Lineage for d1nsnh2 (1nsn H:115-223)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53888Species Fab N10 (mouse), kappa L chain [49023] (1 PDB entry)
  8. 53889Domain d1nsnh2: 1nsn H:115-223 [21103]
    Other proteins in same PDB: d1nsnh1, d1nsnl1, d1nsns_

Details for d1nsnh2

PDB Entry: 1nsn (more details), 2.9 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution

SCOP Domain Sequences for d1nsnh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsnh2 b.1.1.2 (H:115-223) Immunoglobulin (constant domains of L and H chains) {Fab N10 (mouse), kappa L chain}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpssprpsetvtcnvahpasstkvdkki

SCOP Domain Coordinates for d1nsnh2:

Click to download the PDB-style file with coordinates for d1nsnh2.
(The format of our PDB-style files is described here.)

Timeline for d1nsnh2: