Lineage for d1nsnl2 (1nsn L:108-213)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289932Domain d1nsnl2: 1nsn L:108-213 [21102]
    Other proteins in same PDB: d1nsnh1, d1nsnh2, d1nsnl1, d1nsns_
    part of Fab N10

Details for d1nsnl2

PDB Entry: 1nsn (more details), 2.9 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution

SCOP Domain Sequences for d1nsnl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsnl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1nsnl2:

Click to download the PDB-style file with coordinates for d1nsnl2.
(The format of our PDB-style files is described here.)

Timeline for d1nsnl2: