SCOP 1.63: Domain d1nsnl2: 1nsn L:108-213

Lineage for d1nsnl2 (1nsn L:108-213)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab N10 (mouse), kappa L chain [49023] (1 PDB entry)

8. Domain d1nsnl2: 1nsn L:108-213 [21102]
   Other proteins in same PDB: d1nsnh1, d1nsnl1, d1nsns_

Details for d1nsnl2

PDB Entry: 1nsn, 2.9 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution

SCOP Domain Sequences for d1nsnl2:

Sequence; same for both SEQRES and ATOM records:

>d1nsnl2 b.1.1.2 (L:108-213) Immunoglobulin (constant domains of L and H chains) {Fab N10 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1nsnl2:

• d1nsnl2 first appeared (with stable ids) in SCOP 1.55
  
• d1nsnl2 appears in SCOP 1.61
  
• d1nsnl2 appears in SCOP 1.65
  
• d1nsnl2 appears in the current release, SCOPe 2.08