SCOPe 2.03: Domain d3hg2b2: 3hg2 B:324-422

Lineage for d3hg2b2 (3hg2 B:324-422)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (11 PDB entries)
   alpha-galactosidase A

8. Domain d3hg2b2: 3hg2 B:324-422 [211019]
   Other proteins in same PDB: d3hg2a1, d3hg2b1
   automated match to d1r46b1
   complexed with acy, gal, nag, so4

Details for d3hg2b2

PDB Entry: 3hg2, 2.3 Å

PDB Description: human alpha-galactosidase catalytic mechanism 1. empty active site

PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d3hg2b2:

Sequence; same for both SEQRES and ATOM records:

>d3hg2b2 b.71.1.1 (B:324-422) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmq

Timeline for d3hg2b2:

• d3hg2b2 is new in SCOPe 2.03-stable
  
• d3hg2b2 appears in SCOPe 2.04
  
• d3hg2b2 appears in the current release, SCOPe 2.08