Lineage for d1opgh2 (1opg H:126-227)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221018Species Anti-integrin Fab OPG2 (mouse), kappa L chain [49022] (2 PDB entries)
  8. 221021Domain d1opgh2: 1opg H:126-227 [21101]
    Other proteins in same PDB: d1opgh1, d1opgl1

Details for d1opgh2

PDB Entry: 1opg (more details), 2 Å

PDB Description: opg2 fab fragment

SCOP Domain Sequences for d1opgh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opgh2 b.1.1.2 (H:126-227) Immunoglobulin (constant domains of L and H chains) {Anti-integrin Fab OPG2 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1opgh2:

Click to download the PDB-style file with coordinates for d1opgh2.
(The format of our PDB-style files is described here.)

Timeline for d1opgh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1opgh1