Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (83 species) not a true protein |
Species Geobacter metallireducens [TaxId:269799] [225685] (1 PDB entry) |
Domain d3hdob_: 3hdo B: [211003] automated match to d3getb_ complexed with gol, mg |
PDB Entry: 3hdo (more details), 1.61 Å
SCOPe Domain Sequences for d3hdob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdob_ c.67.1.0 (B:) automated matches {Geobacter metallireducens [TaxId: 269799]} iplrqniasmkgyipgyqppdiaswiklntnenpyppspevvkaileelgpdgaalriyp sassqklrevagelygfdpswiimangsdevlnnlirafaaegeeigyvhpsysyygtla evqgarvrtfgltgdfriagfperyegkvfflttpnaplgpsfpleyidelarrcagmlv ldetyaefaesnalelvrrhenvvvtrtlsksyslagmriglaiarpeviaaldkirdhy nldrlaqaacvaalrdqaylseccrriretrewfttelrsigydvipsqgnylfatppdr dgkrvydglyarkvlvrhfsdpllahgmrisigtreemeqtlaalkeig
Timeline for d3hdob_: