Lineage for d3hdob_ (3hdo B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614559Species Geobacter metallireducens [TaxId:269799] [225685] (1 PDB entry)
  8. 1614561Domain d3hdob_: 3hdo B: [211003]
    automated match to d3getb_
    complexed with gol, mg

Details for d3hdob_

PDB Entry: 3hdo (more details), 1.61 Å

PDB Description: crystal structure of a histidinol-phosphate aminotransferase from geobacter metallireducens
PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3hdob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdob_ c.67.1.0 (B:) automated matches {Geobacter metallireducens [TaxId: 269799]}
iplrqniasmkgyipgyqppdiaswiklntnenpyppspevvkaileelgpdgaalriyp
sassqklrevagelygfdpswiimangsdevlnnlirafaaegeeigyvhpsysyygtla
evqgarvrtfgltgdfriagfperyegkvfflttpnaplgpsfpleyidelarrcagmlv
ldetyaefaesnalelvrrhenvvvtrtlsksyslagmriglaiarpeviaaldkirdhy
nldrlaqaacvaalrdqaylseccrriretrewfttelrsigydvipsqgnylfatppdr
dgkrvydglyarkvlvrhfsdpllahgmrisigtreemeqtlaalkeig

SCOPe Domain Coordinates for d3hdob_:

Click to download the PDB-style file with coordinates for d3hdob_.
(The format of our PDB-style files is described here.)

Timeline for d3hdob_: