Class b: All beta proteins [48724] (178 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.7: beta-Roll [51120] (2 families) superhelix turns are made of two short strands each |
Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein) duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain |
Protein Metalloprotease [51122] (4 species) The catalytic N-terminal domain belong to the "zincin" superfamily |
Species Erwinia chrysanthemi [TaxId:556] [82189] (9 PDB entries) protease C |
Domain d3hdap1: 3hda P:259-479 [211001] Other proteins in same PDB: d3hdap2 automated match to d1af0a1 complexed with ca, cl; mutant |
PDB Entry: 3hda (more details), 2.13 Å
SCOPe Domain Sequences for d3hdap1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdap1 b.80.7.1 (P:259-479) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} ganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinln egsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadt lyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqe vmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv
Timeline for d3hdap1: