SCOPe 2.03: Domain d3hc4l2: 3hc4 L:108-213

Lineage for d3hc4l2 (3hc4 L:108-213)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d3hc4l2: 3hc4 L:108-213 [211000]
   Other proteins in same PDB: d3hc4l1
   automated match to d1rhha2
   complexed with act, zn; mutant

Details for d3hc4l2

PDB Entry: 3hc4, 1.62 Å

PDB Description: BHA10 IgG1 Fab quadruple mutant variant - antibody directed at human LTBR

PDB Compounds: (L:) immunoglobulin IgG1 Fab, light chain

SCOPe Domain Sequences for d3hc4l2:

Sequence; same for both SEQRES and ATOM records:

>d3hc4l2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3hc4l2:

• d3hc4l2 is new in SCOPe 2.03-stable
  
• d3hc4l2 appears in SCOPe 2.04
  
• d3hc4l2 appears in the current release, SCOPe 2.08