Lineage for d3hc2a1 (3hc2 A:95-343)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237226Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif
  4. 2237227Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families) (S)
  5. 2237265Family d.176.1.0: automated matches [227253] (1 protein)
    not a true family
  6. 2237266Protein automated matches [227034] (1 species)
    not a true protein
  7. 2237267Species Chicken (Gallus gallus) [TaxId:9031] [225869] (6 PDB entries)
  8. 2237272Domain d3hc2a1: 3hc2 A:95-343 [210995]
    Other proteins in same PDB: d3hc2a2
    automated match to d1ogpa2
    complexed with mo, mte; mutant

Details for d3hc2a1

PDB Entry: 3hc2 (more details), 2.5 Å

PDB Description: crystal structure of chicken sulfite oxidase mutant tyr 322 phe
PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d3hc2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hc2a1 d.176.1.0 (A:95-343) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
dpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrlr
vdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarw
ggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllayem
ngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndfkgfspcvdwdtv
dyrtapaiq

SCOPe Domain Coordinates for d3hc2a1:

Click to download the PDB-style file with coordinates for d3hc2a1.
(The format of our PDB-style files is described here.)

Timeline for d3hc2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hc2a2