Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d3hc0l2: 3hc0 L:108-212 [210994] Other proteins in same PDB: d3hc0b1, d3hc0l1 automated match to d3fcta2 complexed with act |
PDB Entry: 3hc0 (more details), 1.9 Å
SCOPe Domain Sequences for d3hc0l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hc0l2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d3hc0l2: