SCOPe 2.07: Domain d3hbvp1: 3hbv P:259-479

Lineage for d3hbvp1 (3hbv P:259-479)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.7: beta-Roll [51120] (2 families)
   superhelix turns are made of two short strands each

5. Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
   duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
   this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain

6. Protein Metalloprotease [51122] (4 species)
   The catalytic N-terminal domain belong to the "zincin" superfamily

7. Species Erwinia chrysanthemi [TaxId:556] [82189] (9 PDB entries)
   protease C

8. Domain d3hbvp1: 3hbv P:259-479 [210990]
   Other proteins in same PDB: d3hbvp2
   automated match to d1af0a1
   complexed with ca, cl, zn; mutant

Details for d3hbvp1

PDB Entry: 3hbv, 1.95 Å

PDB Description: prtc methionine mutants: m226a in-house

PDB Compounds: (P:) secreted protease C

SCOPe Domain Sequences for d3hbvp1:

Sequence; same for both SEQRES and ATOM records:

>d3hbvp1 b.80.7.1 (P:259-479) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
ganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinln
egsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadt
lyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqe
vmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv

Timeline for d3hbvp1:

• d3hbvp1 first appeared in SCOPe 2.03
  
• d3hbvp1 appears in SCOPe 2.06
  
• d3hbvp1 appears in the current release, SCOPe 2.08