Lineage for d3hbvp1 (3hbv P:259-479)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079406Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079669Superfamily b.80.7: beta-Roll [51120] (2 families) (S)
    superhelix turns are made of two short strands each
  5. 2079670Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
    duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
    this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain
  6. 2079671Protein Metalloprotease [51122] (4 species)
    The catalytic N-terminal domain belong to the "zincin" superfamily
  7. 2079672Species Erwinia chrysanthemi [TaxId:556] [82189] (9 PDB entries)
    protease C
  8. 2079676Domain d3hbvp1: 3hbv P:259-479 [210990]
    Other proteins in same PDB: d3hbvp2
    automated match to d1af0a1
    complexed with ca, cl, zn; mutant

Details for d3hbvp1

PDB Entry: 3hbv (more details), 1.95 Å

PDB Description: prtc methionine mutants: m226a in-house
PDB Compounds: (P:) secreted protease C

SCOPe Domain Sequences for d3hbvp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hbvp1 b.80.7.1 (P:259-479) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
ganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinln
egsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadt
lyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqe
vmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv

SCOPe Domain Coordinates for d3hbvp1:

Click to download the PDB-style file with coordinates for d3hbvp1.
(The format of our PDB-style files is described here.)

Timeline for d3hbvp1: