Lineage for d3hbup2 (3hbu P:259-479)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329661Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1329896Superfamily b.80.7: beta-Roll [51120] (2 families) (S)
    superhelix turns are made of two short strands each
  5. 1329897Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
    duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
    this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain
  6. 1329898Protein Metalloprotease [51122] (4 species)
    The catalytic N-terminal domain belong to the "zincin" superfamily
  7. 1329899Species Erwinia chrysanthemi [TaxId:556] [82189] (9 PDB entries)
    protease C
  8. 1329902Domain d3hbup2: 3hbu P:259-479 [210989]
    Other proteins in same PDB: d3hbup1
    automated match to d1af0a1
    complexed with ca, cl, zn; mutant

Details for d3hbup2

PDB Entry: 3hbu (more details), 1.77 Å

PDB Description: prtc methionine mutants: m226h desy
PDB Compounds: (P:) secreted protease C

SCOPe Domain Sequences for d3hbup2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hbup2 b.80.7.1 (P:259-479) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
ganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinln
egsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadt
lyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqe
vmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv

SCOPe Domain Coordinates for d3hbup2:

Click to download the PDB-style file with coordinates for d3hbup2.
(The format of our PDB-style files is described here.)

Timeline for d3hbup2: