Lineage for d3hbup1 (3hbu P:18-258)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570586Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 2570587Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 2570588Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries)
    Protease C
  8. 2570595Domain d3hbup1: 3hbu P:18-258 [210988]
    Other proteins in same PDB: d3hbup2
    automated match to d1af0a2
    complexed with ca, cl, zn; mutant

Details for d3hbup1

PDB Entry: 3hbu (more details), 1.77 Å

PDB Description: prtc methionine mutants: m226h desy
PDB Compounds: (P:) secreted protease C

SCOPe Domain Sequences for d3hbup1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hbup1 d.92.1.6 (P:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalgla
hpgeynagegdpsyndavyaedsyqfsihsywgenetgadynghyggapmiddiaaiqrl
y

SCOPe Domain Coordinates for d3hbup1:

Click to download the PDB-style file with coordinates for d3hbup1.
(The format of our PDB-style files is described here.)

Timeline for d3hbup1: