Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries) Protease C |
Domain d3hbup1: 3hbu P:18-258 [210988] Other proteins in same PDB: d3hbup2 automated match to d1af0a2 complexed with ca, cl, zn; mutant |
PDB Entry: 3hbu (more details), 1.77 Å
SCOPe Domain Sequences for d3hbup1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hbup1 d.92.1.6 (P:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalgla hpgeynagegdpsyndavyaedsyqfsihsywgenetgadynghyggapmiddiaaiqrl y
Timeline for d3hbup1: