Lineage for d3hbqa1 (3hbq A:94-343)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561501Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif
  4. 2561502Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families) (S)
  5. 2561540Family d.176.1.0: automated matches [227253] (1 protein)
    not a true family
  6. 2561541Protein automated matches [227034] (1 species)
    not a true protein
  7. 2561542Species Chicken (Gallus gallus) [TaxId:9031] [225869] (6 PDB entries)
  8. 2561548Domain d3hbqa1: 3hbq A:94-343 [210980]
    Other proteins in same PDB: d3hbqa2
    automated match to d1ogpa2
    complexed with gol, mom, mte; mutant

Details for d3hbqa1

PDB Entry: 3hbq (more details), 2.8 Å

PDB Description: structure of recombinant chicken liver sulfite oxidase mutant cys 185 ala
PDB Compounds: (A:) Sulphite oxide

SCOPe Domain Sequences for d3hbqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hbqa1 d.176.1.0 (A:94-343) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl
rvdgpgggtlslslaelrsrfpkhevtatlqaagnrrsemsrvrpvkglpwdigaistar
wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye
mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdt
vdyrtapaiq

SCOPe Domain Coordinates for d3hbqa1:

Click to download the PDB-style file with coordinates for d3hbqa1.
(The format of our PDB-style files is described here.)

Timeline for d3hbqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hbqa2