Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (22 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225870] (6 PDB entries) |
Domain d3hbpa2: 3hbp A:344-466 [210979] Other proteins in same PDB: d3hbpa1 automated match to d1ogpa1 complexed with mom, mte, so3; mutant |
PDB Entry: 3hbp (more details), 2.4 Å
SCOPe Domain Sequences for d3hbpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hbpa2 b.1.18.0 (A:344-466) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs vqd
Timeline for d3hbpa2: